PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G25360.1
Common NameLOC102704887
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 295aa    MW: 32484.1 Da    PI: 6.3489
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G25360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-182370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed llv+ v+q+G g+W+++++  g++R++k+c++rw +yl
     OB04G25360.1 23 KGPWTSQEDALLVEHVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 70
                     79********************************************97 PP

2Myb_DNA-binding54.13.5e-1776120147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
     OB04G25360.1  76 RGKITPQEESIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 120
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5181870IPR017930Myb domain
SuperFamilySSF466893.45E-2921117IPR009057Homeodomain-like
SMARTSM007171.5E-152272IPR001005SANT/Myb domain
PfamPF002491.1E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-232477IPR009057Homeodomain-like
CDDcd001676.91E-112570No hitNo description
PROSITE profilePS5129425.39671125IPR017930Myb domain
SMARTSM007176.6E-1675123IPR001005SANT/Myb domain
PfamPF002491.1E-1476120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-2478123IPR009057Homeodomain-like
CDDcd001673.54E-1080121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAAEVQSAGW GRHEQQDGGA WRKGPWTSQE DALLVEHVRQ HGEGRWNSVS KLTGLKRSGK  60
SCRLRWVNYL RPDLKRGKIT PQEESIIVQL HALWGNRWST IARSLPGRTD NEIKNYWRTH  120
FKKGKPSKNI ERARARFLKQ RREMQESQLQ RQQQAPTPQS KDDDDVVVVA VAEARGSWTD  180
DDDVMGGAAV APPPSSPTPT PTPGREAEEL IMHQDAMDDL MLCPAMSYHL LLLHGAAGHH  240
QLSDGGGGGS CCASTSEDQY GSSEEDGATW GSLWNLDGVV VDADADAAAG ACTLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-262312327126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096200.0AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015691883.10.0PREDICTED: myb-related protein MYBAS2
TrEMBLJ3LZG10.0J3LZG1_ORYBR; Uncharacterized protein
STRINGOB04G25360.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.15e-66myb domain protein 79